Recombinant Human Vascular Endothelial Growth Factor 165, Yeast-derived

Key features and details

Target: VEGF 165
Source / Expression System: Expressed in Pichia Pastoris.
Abbreviation: rHuVEGF165, Yeast-derived
Molecular Weight: 38.2 kDa

Brand:

CAT.NO. : ARP6617Y

US$ Please choose

Size:

50μg

Trail, Bulk size or Custom requests Please contact us

Product Details

Background

Vascular Endothelial Growth Factor is a sub-family of growth factors produced by cells, which stimulates vasculogenesis and angiogenesis. VEGF's normal function is to create new blood vessels during embryonic development, new blood vessels after injury, muscle following exercise, and new vessels (collateral circulation) to bypass blocked vessels. VEGF production can be induced in cells that are not receiving enough oxygen. VEGF165 appears to be the most abundant and potent isoform, followed by VEGF121 and VEGF189. In addition, it shares 88 % a.a. with corresponding regions of mouse and rat, 96 % with porcine, 95 % with canine, and 93 % with feline, equine and bovine VEGF, respectively. Recombinant human VEGF165 contains 165 amino acids residues and it is a disulfide-linked homodimer.

Overview

Abbreviation	rHuVEGF165, Yeast-derived
Source / Expression System	Expressed in Pichia Pastoris.
Molecular Weight	Approximately 38.2 kDa, a disulfide-linked homodimeric protein consisting of two 165 amino acid polypeptide chains. As a result of glycosylation, it migrates to at least three bands with molecular weights ranging from 20-31 kDa in SDS-PAGE under reducing conditions.
Accession #	P15692 (Ala27-Arg191 with an N-terminal Met)
A.A. Sequence	MAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Purity	＞96% by SDS-PAGE or HPLC.
Biological Activity	Fully biologically active when compared to standard. Determined by the dose-dependent stimulation of the proliferation of human umbilical vein endothelial cells (HUVEC) using a concentration range of 1.0-8.0 ng/ml.
Formulation	Lyophilized from a 0.2 μm filtered concentrated solution in PBS, with 0.02% Tween-20, pH 7.4.
Appearance	Sterile filtered White lyophilized (freeze-dried) powder.
Endotoxin	< 0.01 EU/μg of rHuVEGF165 protein as determined by LAL method.
Reconstitution Instruction	Before use this product, please read the direction below carefully. This vial must be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in a sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/ml. Stock solutions should be apportioned into working aliquots and stored at ≤ -20℃. Further dilutions should be made in appropriate buffered solutions.

Data

SDS-PAGE

Storage

For long term storage, the product should be stored ≤ -20℃. Please avoid repeated freeze-thaw cycles after reconstitution. 36 months from date of receipt, -20 to -70℃ as supplied. 1 month, 2 to 8℃ under sterile conditions after reconstitution. 3 months, -20 to -70℃ under sterile conditions after reconstitution.

Research Use Only

For Research Use Only. Not for use in diagnostic procedures.

New Products

Recombinant Human Vascular Endothelial Growth Factor 165, Yeast-derived

Recombinant Mouse VEGFR2 (C-Fc) Protein

TRBC1 Mouse Monoclonal Antibody(ARA662)

Mouse monoclonal to TRBC1

OCT2 Mouse Monoclonal Antibody(C2325)

Mouse monoclonal antibody to OCT2

ARExVisual® DAB Buffer

Primary Antibody Diluent