Recombinant Human Leptin

Key features and details

Species: Human
Abbreviation: rHuLeptin
Source: Expressed in E. coli.
Molecular Weight: Approximately 16.0 kDa, a single non-glycosylated polypeptide chain containing 146 amino acids.
Purity: ＞97% by SDS-PAGE or HPLC.
Endotoxin: < 0.01 EU/μg of rHuLeptin protein as determined by LAL method.
Accession #: P41159 Val22-Cys167
Storage: -20.0°C

Brand:

CAT.NO. : ARP6745

US$ Please choose

Size:

1mg

Trail, Bulk size or Custom requests Please contact us

Product Details

Background

Encoded by the ob (obese) gene, Leptin is an adipose-derived cytokine that suppresses appetite and increases thermogenesis. The absence of leptin (or its receptor) leads to uncontrolled food intake and resulting obesity. Leptin exerts its anorectic effect via signaling through a hypothalamic receptor termed OB-R. Leptin has been shown to reduce body weight, food consumption, and plasma glucose levels in various in vivo models. Recombinant Human Leptin is a 16.0kDa protein containing 146 amino acid residues.

Overview

Product Name	Recombinant Human Leptin (rHuLeptin)
Synonyms	Obesity protein, OB
Source	Expressed in E. coli
Molecular Weight	Approximately 16.0 kDa, a single non-glycosylated polypeptide chain containing 146 amino acids
Accession	P41159 Val22-Cys167
AA Sequence	VPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC
Purity	>97% by SDS-PAGE or HPLC
Biological Activity	Fully biologically active when compared to standard. The ED₅₀ as determined by a chemotaxis bioassay using human Leptin R transfected BaF3 murine proB cells is less than 2ng/ml, corresponding to a specific activity of > 5.0×10⁵ IU/mg
Formulation	Lyophilized from a 0.2µm filtered concentrated solution in 50mM MPB, pH 3.5, with 0.02% Tween-20
Endotoxin Level	<0.01EU/µg rHuLeptin protein as determined by LAL method
Reconstitution	Before use this product, please read the direction below carefully. 1. This vial must be briefly centrifuged prior to opening to bring the contents to the bottom. 2. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/ml. Stock solutions should be apportioned into working aliquots and stored at ≤ -20°C. Further dilutions should be made in appropriate buffered solutions.

Data

SDS-PAGE

Storage

For long term storage, the product should be stored ≤-20℃
36 months, -20 to -70℃ as supplied.
1 month, 2 to 8℃ under sterile conditions after reconstitution;
3 months, -20 to -70℃ under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Note

For Research Use Only. Not for use in diagnostic procedures.

New Products

hCG alpha Mouse Monoclonal Antibody(ARA629)

E.coli Residual Total RNA Detection Kit (RT-PCR)

Fibronectin Rabbit Monoclonal Antibody(C6)

Antigen Retrieval Solution II (EDTA)

Antigen Retrieval Solution I (Citrate)

Hyaluronic Acid ELISA Kit