Recombinant Human CD74 Protein
Key features and details
- Target:
- Expression host:
- Purification tag:
- Storage:
-
Brand:
CAT.NO. : AXP6639
US$ Please choose
US$ Please choose
Size:
Trail, Bulk size or Custom requests Please contact us
Product Details
Background
CD74 molecule (CD74), also known as the invariant chain, is a non-polymorphic transmembrane glycoprotein that plays a central role in the immune system by acting as a molecular chaperone for major histocompatibility complex class II (MHC II) molecules. It stabilizes peptide-free MHC II alpha/beta heterodimers after their synthesis, promotes their exit from the endoplasmic reticulum, and directs them to endocytic compartments for antigen processing and presentation. Beyond its chaperone function, CD74 serves as a high-affinity cell surface receptor for macrophage migration inhibitory factor (MIF) and d-dopachrome tautomerase (D-DT/MIF2), as well as a functional receptor for tissue inhibitor of metalloproteinases-1 (TIMP-1), and regulates the transport of the angiotensin II type I receptor. Through interactions with these ligands and signaling partners such as CD44, CD74 activates multiple intracellular pathways—including PI3K/Akt, AMPK, NF-κB, and ERK—that influence B cell maturation, cell proliferation, and energy metabolism. Dysregulation of CD74 is implicated in the pathogenesis of several diseases, including ischemic heart disease, atherosclerosis, hepatic fibrosis, immunological disorders, and various cancers.
Overview
|
Alternative protein names |
HLA class II histocompatibility antigen gamma chain; HLA-DR antigens-associated invariant chain; Ia antigen-associated invariant chain; Ii; CD antigen CD74) [Cleaved into: Class-II-associated invariant chain peptide; CLIP] |
|
Gene name |
CD74 |
|
UniProt Accession |
P04233 (Human) |
|
Organism |
Homo sapiens (Human) |
|
Product name |
Recombinant Human CD74 Protein |
|
Theoretical molecular mass |
26.5 kDa |
|
Expression host |
HEK293 |
|
Purification tag |
6xHis at C-terminus |
|
Usage |
This product is validated for use as an immunogen and as a reagent in immunological assays. |
|
Formulation |
Liquid, Phosphate buffered saline. |
Core sequence
LTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKVLTKCQEEVSHIPAVHPGSFRPKCDENGNYLPLQCYGSIGYCWCVFPNGTEVPNTRSRGHHNCSESLELEDPSSGLGVTKQD
Note: The core sequence of the recombinant protein is shown above. The N and C termini have shortened by 0-10 amino acids. The exact sequence is proprietary information.
Note: The core sequence of the recombinant protein is shown above. The N and C termini have shortened by 0-10 amino acids. The exact sequence is proprietary information.
Data
The purified protein was run on 15% SDS-PAGE at reducing conditions. The gel was then stained with Coomassie brilliant blue and destained.
Western Blotting using HRP conjugated 6xHis antibody.
Note: The molecular weight of the protein as observed on SDS-PACGE under reducing conditions may differ from its predicted value, due to glycosylation.
Storage
Shipped on dry ice.
Upon receipt,
* 2 days when stored at 2 to 8 °C.
* 12 months when aliquoted and stored at -20 °C or below. Avoid repeated freeze-thaw cycles.
Upon receipt,
* 2 days when stored at 2 to 8 °C.
* 12 months when aliquoted and stored at -20 °C or below. Avoid repeated freeze-thaw cycles.
Research Use Only
For Research Use Only. Not for use in diagnostic procedures.
New Products
Mouse monoclonal to TRBC1
Mouse monoclonal antibody to OCT2
