CD74 Mouse Monoclonal Antibody(ARA635)

Key features and details

  • Target: CD74
  • Host: Mouse
  • Reactivity: Human
  • Clonality: Monoclonal
  • Application: Sandwich ELISA
  • Storage: -20°C
  • Brand:
CAT.NO. : ARA6339
US$ Please choose
US$ Please choose
Size:
Trail, Bulk size or Custom requests Please contact us
Product Details
Background
CD74 molecule (CD74), also known as the invariant chain, is a non-polymorphic transmembrane glycoprotein that plays a central role in the immune system by acting as a molecular chaperone for major histocompatibility complex class II (MHC II) molecules. It stabilizes peptide-free MHC II alpha/beta heterodimers after their synthesis, promotes their exit from the endoplasmic reticulum, and directs them to endocytic compartments for antigen processing and presentation. Beyond its chaperone function, CD74 serves as a high-affinity cell surface receptor for macrophage migration inhibitory factor (MIF) and d-dopachrome tautomerase (D-DT/MIF2), as well as a functional receptor for tissue inhibitor of metalloproteinases-1 (TIMP-1), and regulates the transport of the angiotensin II type I receptor. Through interactions with these ligands and signaling partners such as CD44, CD74 activates multiple intracellular pathways—including PI3K/Akt, AMPK, NF-κB, and ERK—that influence B cell maturation, cell proliferation, and energy metabolism. Dysregulation of CD74 is implicated in the pathogenesis of several diseases, including ischemic heart disease, atherosclerosis, hepatic fibrosis, immunological disorders, and various cancers.
Overview

Isotype

IgG1

Species Reactivity

Human

Formulation

Phosphate-buffered saline (PBS), carrier-free, with optional 0.09% sodium azide

Uniprot Accession

P04233 (Human)

Alternative protein names

HLA class II histocompatibility antigen gamma chain; HLA-DR antigens-associated invariant chain; Ia antigen-associated invariant chain; Ii; CD antigen CD74; [Cleaved into: Class-II-associated invariant chain peptide; CLIP]

Gene Name

CD74

Alternative gene name

DHLAG

Immunogen Core Sequence

LTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKVLTKCQEEVS HIPAVHPGSFRPKCDENGNYLPLQCYGSIGYCWCVFPNGTEVPNTRSRGHHNCSESLELED PSSGLGVTKQD

Identity-Mouse (%)

75%

Homologies

Highest antigen sequence identity to the following orthologs: Mouse - 75%, Rat - 78%, Pig - 77%, Cynomolgus monkey - 95%

*AREX continuously optimizes our products. Webpage content may not reflect the latest updates. For inquiries, please contact info@arexbio.com or your local distributor.
*Clone Number, Reactivity, Source/Host and Clonality can be found in the product name and Key Features section above.
Storage
Shipped at 4℃. Store at -20℃ for one year. Avoid repeated freeze/thaw cycles.
Note
For Research Use Only. Not for diagnostic, therapeutics, prophylactic or in vivo use.
FAQs
What are the main types of research antibodies and how do they differ?
Research antibodies are mainly divided into monoclonal antibodies and polyclonal antibodies. Monoclonal antibodies typically offer higher specificity and better batch-to-batch consistency, while polyclonal antibodies often provide stronger affinity but may show more variation between batches. The choice depends on your specific experimental needs.
How can I tell if a research antibody is suitable for my experiment?
It is recommended to carefully review the product datasheet for validated applications, species reactivity, recommended dilutions, and published references. For new antibodies, performing a small-scale validation with positive control samples is usually helpful.
Can improper storage of research antibodies affect experimental results?
Yes. Antibodies are sensitive to temperature, repeated freeze-thaw cycles, and contamination. Improper storage may lead to reduced activity, increased background, or weaker signals. It is best to follow the storage instructions provided in the product datasheet.
Why doesn’t the recommended dilution in the datasheet work well in my experiment?
The recommended dilution is based on the supplier’s test conditions. Factors such as sample type, fixation method, and detection system in your lab can influence the optimal working concentration. Performing a dilution series optimization in your own system is often necessary.
What precautions should I take when using a newly purchased research antibody for the first time?
It is advisable to briefly centrifuge the antibody (especially concentrated or lyophilized ones), then perform a small-scale pilot experiment using the recommended conditions. Recording the batch number and usage date is also helpful for future tracking.
New Products
Get in touch with AREX
Name:*
Tel/Phone:*
Company:*
Email:*
Inquiry:
Captcha*
Submitting your email information means that you are willing to receive email information from AREX regarding technology, applications, products, and events. By clicking on the 'unsubscribe' button in the email or by contacting info@arexbio.com You can unsubscribe at any time by sending an email. Regarding your data usage information, please refer to our privacy policy.
© AREX 2024. All Rights Reserved. Sitemap
0.180327s