Recombinant Human USP20 Protein

Datasheet

Key features and details

Target: USP20
Expression Systems: Escherichia coli
Species: Human
Tag: C-His
Modification: unmodified
Storage: -20℃

Brand:

CAT.NO. : AXP6641

US$ Please choose

Size:

20μg 100μg

Trail, Bulk size or Custom requests Please contact us

Product Details

Background

SLAIN2 is closely related to SLAIN1, a novel stem cell protein that is expressed at the stem cell and epiblast stages. Unlike SLAIN1, SLAIN2 is widely expressed and is thought to play a role in regulating microtubule (MT) growth and organization. SLAIN2 binds to end-binding proteins (EBs), cytoplasmic linker proteins (CLIPs) such as CLIP170, CLIP-associated proteins, and interacts with the MT polymerase ch-TOG. Depletion of SLAIN2 using RNAi led to disorganization of the radial MT array, indicating its importance in the regulation of MT growth and organization.

Overview

Protein name	Ubiquitin specific peptidase 20
Alternative protein names	Ubiquitin carboxyl-terminal hydrolase 20; Deubiquitinating enzyme 20; Ubiquitin thioesterase 20; Ubiquitin-specific-processing protease 20; VHL-interacting deubiquitinating enzyme 2; hVDU2
Gene name	USP20
Alternative gene name	KIAA1003; LSFR3A; VDU2
UniProt Accession	Q9Y2K6
Organism	Homo sapiens (Human)
Theoretical/Apparent MW	15 kDa/17 kDa
Expression host	Escherichia coli
Purification tag	6xHis at C-terminus
Form/Buffer	Liquid,Phosphate buffered saline

Data

The purified product was run on 15% SDS-PAGE at reducing conditions. The gel was stained with Coomassie brilliant blue and destained.Note: The molecular weight of the protein as observed on SDS-PAGE under reducing conditions may differ from its predicted value, due to variations in electrophoretic mobilities.

Core sequence

AKRRRIEIDTFIKLNKAFQAEESPGVIYCISMQWFREWEAFVKGKDNEPPGPIDNS
RIAQVKGSGHVQLKQGADYGQISEETWTYLNSLYGGGPEIAIRQSVAQPLGPEN
Note: The core sequence of the recombinant protein is shown above. The N and C termini have shortened by 0-10 amino acids. The exact sequence is proprietary information.

Research Use Only

This product is validated for use as an immunogen and as a reagent in immunological assays.
For Research Use Only. Not for use in diagnostic procedures.

Storage

Shipped on dry ice.
Upon receipt,
* 2 days when stored at 2 to 8 °C.
* 12 months when aliquoted and stored at -20 °C or below. Avoid repeated freeze-thaw cycles.

New Products

ICOS/CD278 Rabbit Monoclonal Antibody(ARA628)

hCG alpha Mouse Monoclonal Antibody(ARA629)

E.coli Residual Total RNA Detection Kit (RT-PCR)

Fibronectin Rabbit Monoclonal Antibody(C6)

Antigen Retrieval Solution II (EDTA)

Antigen Retrieval Solution I (Citrate)